Anti PPP2R2B pAb (ATL-HPA042122)

Atlas Antibodies

Catalog No.: ATL-HPA042122-25

Protein Description: protein phosphatase 2, regulatory subunit B, beta
Gene Name: PPP2R2B
Alternative Gene Name: PR52B, PR55-BETA, SCA12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041769: 100%, ENSRNOG00000018851: 100%
Entrez Gene ID: 5521
Uniprot ID: Q00005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
• Gene Sequence: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
• Gene ID - Mouse: ENSMUSG00000041769
• Gene ID - Rat: ENSRNOG00000018851
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.