Anti PPP2R2B pAb (ATL-HPA038118)

Atlas Antibodies

Catalog No.:
ATL-HPA038118-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 2, regulatory subunit B, beta
Gene Name: PPP2R2B
Alternative Gene Name: PR52B, PR55-BETA, SCA12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033214: 27%, ENSRNOG00000009649: 27%
Entrez Gene ID: 5521
Uniprot ID: Q00005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN
Gene Sequence LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN
Gene ID - Mouse ENSMUSG00000033214
Gene ID - Rat ENSRNOG00000009649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP2R2B pAb (ATL-HPA038118)
Datasheet Anti PPP2R2B pAb (ATL-HPA038118) Datasheet (External Link)
Vendor Page Anti PPP2R2B pAb (ATL-HPA038118) at Atlas Antibodies

Documents & Links for Anti PPP2R2B pAb (ATL-HPA038118)
Datasheet Anti PPP2R2B pAb (ATL-HPA038118) Datasheet (External Link)
Vendor Page Anti PPP2R2B pAb (ATL-HPA038118)