Anti PPP2R2B pAb (ATL-HPA038118)

Atlas Antibodies

Catalog No.: ATL-HPA038118-25

Protein Description: protein phosphatase 2, regulatory subunit B, beta
Gene Name: PPP2R2B
Alternative Gene Name: PR52B, PR55-BETA, SCA12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033214: 27%, ENSRNOG00000009649: 27%
Entrez Gene ID: 5521
Uniprot ID: Q00005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN
• Gene Sequence: LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN
• Gene ID - Mouse: ENSMUSG00000033214
• Gene ID - Rat: ENSRNOG00000009649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.