Anti PPP2CA pAb (ATL-HPA043236)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043236-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PPP2CA
Alternative Gene Name: PP2Calpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020349: 100%, ENSRNOG00000056485: 100%
Entrez Gene ID: 5515
Uniprot ID: P67775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF |
| Gene Sequence | RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF |
| Gene ID - Mouse | ENSMUSG00000020349 |
| Gene ID - Rat | ENSRNOG00000056485 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP2CA pAb (ATL-HPA043236) | |
| Datasheet | Anti PPP2CA pAb (ATL-HPA043236) Datasheet (External Link) |
| Vendor Page | Anti PPP2CA pAb (ATL-HPA043236) at Atlas Antibodies |
| Documents & Links for Anti PPP2CA pAb (ATL-HPA043236) | |
| Datasheet | Anti PPP2CA pAb (ATL-HPA043236) Datasheet (External Link) |
| Vendor Page | Anti PPP2CA pAb (ATL-HPA043236) |