Anti PPP2CA pAb (ATL-HPA043236)

Atlas Antibodies

Catalog No.: ATL-HPA043236-25

Protein Description: protein phosphatase 2, catalytic subunit, alpha isozyme
Gene Name: PPP2CA
Alternative Gene Name: PP2Calpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020349: 100%, ENSRNOG00000056485: 100%
Entrez Gene ID: 5515
Uniprot ID: P67775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
• Gene Sequence: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
• Gene ID - Mouse: ENSMUSG00000020349
• Gene ID - Rat: ENSRNOG00000056485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.