Anti PPP1R37 pAb (ATL-HPA041500)

Atlas Antibodies

Catalog No.: ATL-HPA041500-25

Protein Description: protein phosphatase 1, regulatory subunit 37
Gene Name: PPP1R37
Alternative Gene Name: LRRC68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051403: 94%, ENSRNOG00000017692: 94%
Entrez Gene ID: 284352
Uniprot ID: O75864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHL
• Gene Sequence: TVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHL
• Gene ID - Mouse: ENSMUSG00000051403
• Gene ID - Rat: ENSRNOG00000017692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.