Anti PPP1R37 pAb (ATL-HPA041500)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041500-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPP1R37
Alternative Gene Name: LRRC68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051403: 94%, ENSRNOG00000017692: 94%
Entrez Gene ID: 284352
Uniprot ID: O75864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHL |
| Gene Sequence | TVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHL |
| Gene ID - Mouse | ENSMUSG00000051403 |
| Gene ID - Rat | ENSRNOG00000017692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP1R37 pAb (ATL-HPA041500) | |
| Datasheet | Anti PPP1R37 pAb (ATL-HPA041500) Datasheet (External Link) |
| Vendor Page | Anti PPP1R37 pAb (ATL-HPA041500) at Atlas Antibodies |
| Documents & Links for Anti PPP1R37 pAb (ATL-HPA041500) | |
| Datasheet | Anti PPP1R37 pAb (ATL-HPA041500) Datasheet (External Link) |
| Vendor Page | Anti PPP1R37 pAb (ATL-HPA041500) |