Anti PPP1R12C pAb (ATL-HPA043532)

Atlas Antibodies

Catalog No.: ATL-HPA043532-25

Protein Description: protein phosphatase 1, regulatory subunit 12C
Gene Name: PPP1R12C
Alternative Gene Name: DKFZP434D0412, LENG3, MBS85, p84, p85
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019254: 99%, ENSRNOG00000053828: 99%
Entrez Gene ID: 54776
Uniprot ID: Q9BZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
• Gene Sequence: DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
• Gene ID - Mouse: ENSMUSG00000019254
• Gene ID - Rat: ENSRNOG00000053828
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.