Anti PPM1H pAb (ATL-HPA044244)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044244-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPM1H
Alternative Gene Name: ARHCL1, FLJ13253, KIAA1157, NERPP-2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034613: 93%, ENSRNOG00000004314: 92%
Entrez Gene ID: 57460
Uniprot ID: Q9ULR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESEGVSCHYWSLFDGH |
| Gene Sequence | EDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESEGVSCHYWSLFDGH |
| Gene ID - Mouse | ENSMUSG00000034613 |
| Gene ID - Rat | ENSRNOG00000004314 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPM1H pAb (ATL-HPA044244) | |
| Datasheet | Anti PPM1H pAb (ATL-HPA044244) Datasheet (External Link) |
| Vendor Page | Anti PPM1H pAb (ATL-HPA044244) at Atlas Antibodies |
| Documents & Links for Anti PPM1H pAb (ATL-HPA044244) | |
| Datasheet | Anti PPM1H pAb (ATL-HPA044244) Datasheet (External Link) |
| Vendor Page | Anti PPM1H pAb (ATL-HPA044244) |