Anti PPM1B pAb (ATL-HPA016745)

Atlas Antibodies

Catalog No.:
ATL-HPA016745-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1B
Gene Name: PPM1B
Alternative Gene Name: PP2CB, PP2CBETA, PPC2BETAX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061130: 80%, ENSRNOG00000030667: 85%
Entrez Gene ID: 5495
Uniprot ID: O75688
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL
Gene Sequence KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL
Gene ID - Mouse ENSMUSG00000061130
Gene ID - Rat ENSRNOG00000030667
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPM1B pAb (ATL-HPA016745)
Datasheet Anti PPM1B pAb (ATL-HPA016745) Datasheet (External Link)
Vendor Page Anti PPM1B pAb (ATL-HPA016745) at Atlas Antibodies

Documents & Links for Anti PPM1B pAb (ATL-HPA016745)
Datasheet Anti PPM1B pAb (ATL-HPA016745) Datasheet (External Link)
Vendor Page Anti PPM1B pAb (ATL-HPA016745)