Anti PPIL2 pAb (ATL-HPA035344)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035344-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/88648/161622/atl-hpa035344_anti-ppil2-pab-atl-hpa035344_43261__43527.1681113451.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPIL2
Alternative Gene Name: CYC4, Cyp-60, UBOX7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022771: 81%, ENSRNOG00000026900: 82%
Entrez Gene ID: 23759
Uniprot ID: Q13356
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSS |
| Gene Sequence | MENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSS |
| Gene ID - Mouse | ENSMUSG00000022771 |
| Gene ID - Rat | ENSRNOG00000026900 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPIL2 pAb (ATL-HPA035344) | |
| Datasheet | Anti PPIL2 pAb (ATL-HPA035344) Datasheet (External Link) |
| Vendor Page | Anti PPIL2 pAb (ATL-HPA035344) at Atlas Antibodies |
| Documents & Links for Anti PPIL2 pAb (ATL-HPA035344) | |
| Datasheet | Anti PPIL2 pAb (ATL-HPA035344) Datasheet (External Link) |
| Vendor Page | Anti PPIL2 pAb (ATL-HPA035344) |
| Citations for Anti PPIL2 pAb (ATL-HPA035344) – 2 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Qiu, Zhiyu; Hao, Shuailin; Song, Shikai; Zhang, Ruiling; Yan, Tingyu; Lu, Zhifang; Wang, Hailong; Jia, Zongchao; Zheng, Jimin. PLK1-mediated phosphorylation of PPIL2 regulates HR via CtIP. Frontiers In Cell And Developmental Biology. 10( 36092721):902403. PubMed |