Anti PPIC pAb (ATL-HPA039163)

Atlas Antibodies

Catalog No.: ATL-HPA039163-25

Protein Description: peptidylprolyl isomerase C (cyclophilin C)
Gene Name: PPIC
Alternative Gene Name: CYPC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024538: 88%, ENSRNOG00000017416: 86%
Entrez Gene ID: 5480
Uniprot ID: P45877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW
• Gene Sequence: VFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW
• Gene ID - Mouse: ENSMUSG00000024538
• Gene ID - Rat: ENSRNOG00000017416
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPIC pAb (ATL-HPA039163) – 1 Found

Obermayr, Eva; Reiner, Angelika; Brandt, Burkhard; Braicu, Elena Ioana; Reinthaller, Alexander; Loverix, Liselore; Concin, Nicole; Woelber, Linn; Mahner, Sven; Sehouli, Jalid; Vergote, Ignace; Zeillinger, Robert. The Long-Term Prognostic Significance of Circulating Tumor Cells in Ovarian Cancer-A Study of the OVCAD Consortium. Cancers. 2021;13(11)