Anti PPCS pAb (ATL-HPA031361 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031361-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphopantothenoylcysteine synthetase
Gene Name: PPCS
Alternative Gene Name: FLJ11838
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028636: 93%, ENSRNOG00000008572: 92%
Entrez Gene ID: 79717
Uniprot ID: Q9HAB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADY
Gene Sequence VLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADY
Gene ID - Mouse ENSMUSG00000028636
Gene ID - Rat ENSRNOG00000008572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPCS pAb (ATL-HPA031361 w/enhanced validation)
Datasheet Anti PPCS pAb (ATL-HPA031361 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPCS pAb (ATL-HPA031361 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PPCS pAb (ATL-HPA031361 w/enhanced validation)
Datasheet Anti PPCS pAb (ATL-HPA031361 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPCS pAb (ATL-HPA031361 w/enhanced validation)