Anti PPAN pAb (ATL-HPA043265)

Atlas Antibodies

Catalog No.: ATL-HPA043265-25

Protein Description: peter pan homolog (Drosophila)
Gene Name: PPAN
Alternative Gene Name: BXDC3, SSF, SSF1, SSF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058897: 38%, ENSRNOG00000050706: 38%
Entrez Gene ID: 56342
Uniprot ID: Q9NQ55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
• Gene Sequence: RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
• Gene ID - Mouse: ENSMUSG00000058897
• Gene ID - Rat: ENSRNOG00000050706
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.