Anti PPA2 pAb (ATL-HPA030888)

Atlas Antibodies

Catalog No.:
ATL-HPA030888-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pyrophosphatase (inorganic) 2
Gene Name: PPA2
Alternative Gene Name: FLJ20459
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028013: 56%, ENSRNOG00000012091: 34%
Entrez Gene ID: 27068
Uniprot ID: Q9H2U2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYIS
Gene Sequence MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYIS
Gene ID - Mouse ENSMUSG00000028013
Gene ID - Rat ENSRNOG00000012091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPA2 pAb (ATL-HPA030888)
Datasheet Anti PPA2 pAb (ATL-HPA030888) Datasheet (External Link)
Vendor Page Anti PPA2 pAb (ATL-HPA030888) at Atlas Antibodies

Documents & Links for Anti PPA2 pAb (ATL-HPA030888)
Datasheet Anti PPA2 pAb (ATL-HPA030888) Datasheet (External Link)
Vendor Page Anti PPA2 pAb (ATL-HPA030888)