Anti POU3F4 pAb (ATL-HPA031984)

Atlas Antibodies

Catalog No.: ATL-HPA031984-25

Protein Description: POU class 3 homeobox 4
Gene Name: POU3F4
Alternative Gene Name: BRN4, DFN3, DFNX2, OTF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056854: 98%, ENSRNOG00000002784: 98%
Entrez Gene ID: 5456
Uniprot ID: P49335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
• Gene Sequence: RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
• Gene ID - Mouse: ENSMUSG00000056854
• Gene ID - Rat: ENSRNOG00000002784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POU3F4 pAb (ATL-HPA031984) – 2 Found

Diaz-de-Durana, Yaiza; Lau, Janet; Knee, Deborah; Filippi, Christophe; Londei, Marco; McNamara, Peter; Nasoff, Marc; DiDonato, Michael; Glynne, Richard; Herman, Ann E. IL-2 immunotherapy reveals potential for innate beta cell regeneration in the non-obese diabetic mouse model of autoimmune diabetes. Plos One. 8(10):e78483. 

Hosoya, Makoto; Fujioka, Masato; Murayama, Ayako Y; Okano, Hideyuki; Ogawa, Kaoru. The common marmoset as suitable nonhuman alternative for the analysis of primate cochlear development. The Febs Journal. 2021;288(1):325-353.