Anti POU2F3 pAb (ATL-HPA019652 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019652-25

Protein Description: POU class 2 homeobox 3
Gene Name: POU2F3
Alternative Gene Name: Epoc-1, OCT11, PLA-1, Skn-1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032015: 86%, ENSRNOG00000009118: 84%
Entrez Gene ID: 25833
Uniprot ID: Q9UKI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
• Gene Sequence: LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
• Gene ID - Mouse: ENSMUSG00000032015
• Gene ID - Rat: ENSRNOG00000009118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POU2F3 pAb (ATL-HPA019652 w/enhanced validation) – 7 Found

Ireland, Abbie S; Micinski, Alexi M; Kastner, David W; Guo, Bingqian; Wait, Sarah J; Spainhower, Kyle B; Conley, Christopher C; Chen, Opal S; Guthrie, Matthew R; Soltero, Danny; Qiao, Yi; Huang, Xiaomeng; Tarapcsák, Szabolcs; Devarakonda, Siddhartha; Chalishazar, Milind D; Gertz, Jason; Moser, Justin C; Marth, Gabor; Puri, Sonam; Witt, Benjamin L; Spike, Benjamin T; Oliver, Trudy G. MYC Drives Temporal Evolution of Small Cell Lung Cancer Subtypes by Reprogramming Neuroendocrine Fate. Cancer Cell. 2020;38(1):60-78.e12. 

Olsen, Rachelle R; Ireland, Abbie S; Kastner, David W; Groves, Sarah M; Spainhower, Kyle B; Pozo, Karine; Kelenis, Demetra P; Whitney, Christopher P; Guthrie, Matthew R; Wait, Sarah J; Soltero, Danny; Witt, Benjamin L; Quaranta, Vito; Johnson, Jane E; Oliver, Trudy G. ASCL1 represses a SOX9(+) neural crest stem-like state in small cell lung cancer. Genes & Development. 2021;35(11-12):847-869. 

Huang, Yu-Han; Klingbeil, Olaf; He, Xue-Yan; Wu, Xiaoli S; Arun, Gayatri; Lu, Bin; Somerville, Tim D D; Milazzo, Joseph P; Wilkinson, John E; Demerdash, Osama E; Spector, David L; Egeblad, Mikala; Shi, Junwei; Vakoc, Christopher R. POU2F3 is a master regulator of a tuft cell-like variant of small cell lung cancer. Genes & Development. 2018;32(13-14):915-928. 

Zewdu, Rediet; Mehrabad, Elnaz Mirzaei; Ingram, Kelley; Fang, Pengshu; Gillis, Katherine L; Camolotto, Soledad A; Orstad, Grace; Jones, Alex; Mendoza, Michelle C; Spike, Benjamin T; Snyder, Eric L. An NKX2-1/ERK/WNT feedback loop modulates gastric identity and response to targeted therapy in lung adenocarcinoma. Elife. 2021;10( 33821796) 

Wu, Xiaoli S; He, Xue-Yan; Ipsaro, Jonathan J; Huang, Yu-Han; Preall, Jonathan B; Ng, David; Shue, Yan Ting; Sage, Julien; Egeblad, Mikala; Joshua-Tor, Leemor; Vakoc, Christopher R. OCA-T1 and OCA-T2 are coactivators of POU2F3 in the tuft cell lineage. Nature. 2022;607(7917):169-175. 

Barr, Justinn; Gentile, Maria Elena; Lee, Sunyoung; Kotas, Maya E; Fernanda de Mello Costa, Maria; Holcomb, Nicolas P; Jaquish, Abigail; Palashikar, Gargi; Soewignjo, Marcella; McDaniel, Margaret; Matsumoto, Ichiro; Margolskee, Robert; Von Moltke, Jakob; Cohen, Noam A; Sun, Xin; Vaughan, Andrew E. Injury-induced pulmonary tuft cells are heterogenous, arise independent of key Type 2 cytokines, and are dispensable for dysplastic repair. Elife. 2022;11( 36073526) 

Huang, Huachao; Fang, Yinshan; Jiang, Ming; Zhang, Yihan; Biermann, Jana; Melms, Johannes C; Danielsson, Jennifer A; Yang, Ying; Qiang, Li; Liu, Jia; Zhou, Yiwu; Wang, Manli; Hu, Zhihong; Wang, Timothy C; Saqi, Anjali; Sun, Jie; Matsumoto, Ichiro; Cardoso, Wellington V; Emala, Charles W; Zhu, Jian; Izar, Benjamin; Mou, Hongmei; Que, Jianwen. Contribution of Trp63(CreERT2)-labeled cells to alveolar regeneration is independent of tuft cells. Elife. 2022;11( 36129169)