Anti POU1F1 pAb (ATL-HPA041646 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041646-25

Protein Description: POU class 1 homeobox 1
Gene Name: POU1F1
Alternative Gene Name: GHF-1, PIT1, POU1F1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004842: 95%, ENSRNOG00000000715: 97%
Entrez Gene ID: 5449
Uniprot ID: P28069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
• Gene Sequence: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
• Gene ID - Mouse: ENSMUSG00000004842
• Gene ID - Rat: ENSRNOG00000000715
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POU1F1 pAb (ATL-HPA041646 w/enhanced validation) – 2 Found

Sumislawski, Piotr; Rotermund, Roman; Klose, Silke; Lautenbach, Anne; Wefers, Annika K; Soltwedel, Celina; Mohammadi, Behnam; Jacobsen, Frank; Mawrin, Christian; Flitsch, Jörg; Saeger, Wolfgang. ACTH-secreting pituitary carcinoma with TP53, NF1, ATRX and PTEN mutations Case report and review of the literature. Endocrine. 2022;76(1):228-236. 

Sjöstedt, Evelina; Kolnes, Anders J; Olarescu, Nicoleta C; Mitsios, Nicholas; Hikmet, Feria; Sivertsson, Åsa; Lindskog, Cecilia; Øystese, Kristin A B; Jørgensen, Anders P; Bollerslev, Jens; Casar-Borota, Olivera. TGFBR3L-An Uncharacterised Pituitary Specific Membrane Protein Detected in the Gonadotroph Cells in Non-Neoplastic and Tumour Tissue. Cancers. 2020;13(1)