Anti POP4 pAb (ATL-HPA042748)

Atlas Antibodies

Catalog No.: ATL-HPA042748-25

Protein Description: processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)
Gene Name: POP4
Alternative Gene Name: RPP29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030423: 92%, ENSRNOG00000027646: 93%
Entrez Gene ID:
Uniprot ID: O95707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI
• Gene Sequence: KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI
• Gene ID - Mouse: ENSMUSG00000030423
• Gene ID - Rat: ENSRNOG00000027646
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.