Anti POLR3C pAb (ATL-HPA027508)

Atlas Antibodies

Catalog No.: ATL-HPA027508-25

Protein Description: polymerase (RNA) III (DNA directed) polypeptide C (62kD)
Gene Name: POLR3C
Alternative Gene Name: RPC3, RPC62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028099: 96%, ENSRNOG00000033560: 95%
Entrez Gene ID: 10623
Uniprot ID: Q9BUI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSG
• Gene Sequence: QHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSG
• Gene ID - Mouse: ENSMUSG00000028099
• Gene ID - Rat: ENSRNOG00000033560
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.