Anti POGK pAb (ATL-HPA031630)

Atlas Antibodies

Catalog No.:
ATL-HPA031630-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pogo transposable element with KRAB domain
Gene Name: POGK
Alternative Gene Name: BASS2, KIAA15131, KRBOX2, LST003
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040596: 98%, ENSRNOG00000032058: 98%
Entrez Gene ID: 57645
Uniprot ID: Q9P215
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTV
Gene Sequence QLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTV
Gene ID - Mouse ENSMUSG00000040596
Gene ID - Rat ENSRNOG00000032058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POGK pAb (ATL-HPA031630)
Datasheet Anti POGK pAb (ATL-HPA031630) Datasheet (External Link)
Vendor Page Anti POGK pAb (ATL-HPA031630) at Atlas Antibodies

Documents & Links for Anti POGK pAb (ATL-HPA031630)
Datasheet Anti POGK pAb (ATL-HPA031630) Datasheet (External Link)
Vendor Page Anti POGK pAb (ATL-HPA031630)