Anti PNPO pAb (ATL-HPA023204 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023204-100

Protein Description: pyridoxamine 5'-phosphate oxidase
Gene Name: PNPO
Alternative Gene Name: PDXPO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018659: 92%, ENSRNOG00000046493: 90%
Entrez Gene ID: 55163
Uniprot ID: Q9NVS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
• Gene Sequence: SSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
• Gene ID - Mouse: ENSMUSG00000018659
• Gene ID - Rat: ENSRNOG00000046493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) – 1 Found

Fux, Anja; Pfanzelt, Martin; Kirsch, Volker C; Hoegl, Annabelle; Sieber, Stephan A. Customizing Functionalized Cofactor Mimics to Study the Human Pyridoxal 5'-Phosphate-Binding Proteome. Cell Chemical Biology. 2019;26(10):1461-1468.e7.