Anti PNMA2 pAb (ATL-HPA001936 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001936-25

Protein Description: paraneoplastic Ma antigen 2
Gene Name: PNMA2
Alternative Gene Name: MA2, RGAG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046204: 78%, ENSRNOG00000009815: 82%
Entrez Gene ID: 10687
Uniprot ID: Q9UL42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPELLAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAEKKRWL
• Gene Sequence: KQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPELLAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAEKKRWL
• Gene ID - Mouse: ENSMUSG00000046204
• Gene ID - Rat: ENSRNOG00000009815
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PNMA2 pAb (ATL-HPA001936 w/enhanced validation) – 3 Found

Leja, Justyna; Essaghir, Ahmed; Essand, Magnus; Wester, Kenneth; Oberg, Kjell; Tötterman, Thomas H; Lloyd, Ricardo; Vasmatzis, George; Demoulin, Jean-Baptiste; Giandomenico, Valeria. Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2009;22(2):261-72. 

Cui, Tao; Hurtig, Monica; Elgue, Graciela; Li, Su-Chen; Veronesi, Giulia; Essaghir, Ahmed; Demoulin, Jean-Baptiste; Pelosi, Giuseppe; Alimohammadi, Mohammad; Öberg, Kjell; Giandomenico, Valeria. Paraneoplastic antigen Ma2 autoantibodies as specific blood biomarkers for detection of early recurrence of small intestine neuroendocrine tumors. Plos One. 2010;5(12):e16010. 

Chapman, Michael H; Tidswell, Robert; Dooley, James S; Sandanayake, Neomal S; Cerec, Virginie; Deheragoda, Maesha; Lee, Alvin J X; Swanton, Charles; Andreola, Fausto; Pereira, Stephen P. Whole genome RNA expression profiling of endoscopic biliary brushings provides data suitable for biomarker discovery in cholangiocarcinoma. Journal Of Hepatology. 2012;56(4):877-85.