Anti PMPCB pAb (ATL-HPA040674)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040674-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PMPCB
Alternative Gene Name: MPPB, MPPP52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029017: 79%, ENSRNOG00000012693: 77%
Entrez Gene ID: 9512
Uniprot ID: O75439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVASEDSGLSTCTVGLWIDAG |
| Gene Sequence | WGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVASEDSGLSTCTVGLWIDAG |
| Gene ID - Mouse | ENSMUSG00000029017 |
| Gene ID - Rat | ENSRNOG00000012693 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PMPCB pAb (ATL-HPA040674) | |
| Datasheet | Anti PMPCB pAb (ATL-HPA040674) Datasheet (External Link) |
| Vendor Page | Anti PMPCB pAb (ATL-HPA040674) at Atlas Antibodies |
| Documents & Links for Anti PMPCB pAb (ATL-HPA040674) | |
| Datasheet | Anti PMPCB pAb (ATL-HPA040674) Datasheet (External Link) |
| Vendor Page | Anti PMPCB pAb (ATL-HPA040674) |