Anti PMPCA pAb (ATL-HPA021648 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021648-25

Protein Description: peptidase (mitochondrial processing) alpha
Gene Name: PMPCA
Alternative Gene Name: Alpha-MPP, INPP5E, KIAA0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026926: 89%, ENSRNOG00000026775: 92%
Entrez Gene ID: 23203
Uniprot ID: Q10713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
• Gene Sequence: VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
• Gene ID - Mouse: ENSMUSG00000026926
• Gene ID - Rat: ENSRNOG00000026775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PMPCA pAb (ATL-HPA021648 w/enhanced validation) – 2 Found

Lee, Young-Kyoung; Lim, Jin J; Jeoun, Un-Woo; Min, Seongki; Lee, Eun-Beom; Kwon, So Mee; Lee, Changhan; Yoon, Gyesoon. Lactate-mediated mitoribosomal defects impair mitochondrial oxidative phosphorylation and promote hepatoma cell invasiveness. The Journal Of Biological Chemistry. 2017;292(49):20208-20217. 

Cenini, Giovanna; Rüb, Cornelia; Bruderek, Michael; Voos, Wolfgang. Amyloid β-peptides interfere with mitochondrial preprotein import competence by a coaggregation process. Molecular Biology Of The Cell. 2016;27(21):3257-3272.