Anti PLP2 pAb (ATL-HPA042415)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042415-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PLP2
Alternative Gene Name: A4, A4-LSB, MGC126187
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067649: 36%, ENSRNOG00000029260: 36%
Entrez Gene ID: 5355
Uniprot ID: Q04941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP |
| Gene Sequence | RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP |
| Gene ID - Mouse | ENSMUSG00000067649 |
| Gene ID - Rat | ENSRNOG00000029260 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLP2 pAb (ATL-HPA042415) | |
| Datasheet | Anti PLP2 pAb (ATL-HPA042415) Datasheet (External Link) |
| Vendor Page | Anti PLP2 pAb (ATL-HPA042415) at Atlas Antibodies |
| Documents & Links for Anti PLP2 pAb (ATL-HPA042415) | |
| Datasheet | Anti PLP2 pAb (ATL-HPA042415) Datasheet (External Link) |
| Vendor Page | Anti PLP2 pAb (ATL-HPA042415) |