Anti PLP2 pAb (ATL-HPA042415)

Atlas Antibodies

Catalog No.: ATL-HPA042415-25

Protein Description: proteolipid protein 2 (colonic epithelium-enriched)
Gene Name: PLP2
Alternative Gene Name: A4, A4-LSB, MGC126187
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067649: 36%, ENSRNOG00000029260: 36%
Entrez Gene ID: 5355
Uniprot ID: Q04941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP
• Gene Sequence: RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP
• Gene ID - Mouse: ENSMUSG00000067649
• Gene ID - Rat: ENSRNOG00000029260
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.