Anti PLK4 pAb (ATL-HPA043198)

Atlas Antibodies

Catalog No.:
ATL-HPA043198-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: polo like kinase 4
Gene Name: PLK4
Alternative Gene Name: Sak, STK18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025758: 97%, ENSRNOG00000011654: 97%
Entrez Gene ID: 10733
Uniprot ID: O00444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTP
Gene Sequence CLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTP
Gene ID - Mouse ENSMUSG00000025758
Gene ID - Rat ENSRNOG00000011654
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLK4 pAb (ATL-HPA043198)
Datasheet Anti PLK4 pAb (ATL-HPA043198) Datasheet (External Link)
Vendor Page Anti PLK4 pAb (ATL-HPA043198) at Atlas Antibodies

Documents & Links for Anti PLK4 pAb (ATL-HPA043198)
Datasheet Anti PLK4 pAb (ATL-HPA043198) Datasheet (External Link)
Vendor Page Anti PLK4 pAb (ATL-HPA043198)