Anti PLIN2 pAb (ATL-HPA016607)

Atlas Antibodies

Catalog No.:
ATL-HPA016607-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: perilipin 2
Gene Name: PLIN2
Alternative Gene Name: ADFP, ADRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028494: 90%, ENSRNOG00000007060: 83%
Entrez Gene ID: 123
Uniprot ID: Q99541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQ
Gene Sequence ISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQ
Gene ID - Mouse ENSMUSG00000028494
Gene ID - Rat ENSRNOG00000007060
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLIN2 pAb (ATL-HPA016607)
Datasheet Anti PLIN2 pAb (ATL-HPA016607) Datasheet (External Link)
Vendor Page Anti PLIN2 pAb (ATL-HPA016607) at Atlas Antibodies

Documents & Links for Anti PLIN2 pAb (ATL-HPA016607)
Datasheet Anti PLIN2 pAb (ATL-HPA016607) Datasheet (External Link)
Vendor Page Anti PLIN2 pAb (ATL-HPA016607)
Citations for Anti PLIN2 pAb (ATL-HPA016607) – 4 Found
Selen, Ebru S; Wolfgang, Michael J. mTORC1 activation is not sufficient to suppress hepatic PPARα signaling or ketogenesis. The Journal Of Biological Chemistry. 2021;297(1):100884.  PubMed
Selmi-Ruby, Samia; Marín-Sáez, Jesús; Fildier, Aurélie; Buleté, Audrey; Abdallah, Myriam; Garcia, Jessica; Deverchère, Julie; Spinner, Loïc; Giroud, Barbara; Ibanez, Sébastien; Granjon, Thierry; Bardel, Claire; Puisieux, Alain; Fervers, Béatrice; Vulliet, Emmanuelle; Payen, Léa; Vigneron, Arnaud M. In Vivo Characterization of the Toxicological Properties of DPhP, One of the Main Degradation Products of Aryl Phosphate Esters. Environmental Health Perspectives. 2020;128(12):127006.  PubMed
Selen, Ebru S; Choi, Joseph; Wolfgang, Michael J. Discordant hepatic fatty acid oxidation and triglyceride hydrolysis leads to liver disease. Jci Insight. 2021;6(2)  PubMed
Ippolito, Luigi; Comito, Giuseppina; Parri, Matteo; Iozzo, Marta; Duatti, Assia; Virgilio, Francesca; Lorito, Nicla; Bacci, Marina; Pardella, Elisa; Sandrini, Giada; Bianchini, Francesca; Damiano, Roberta; Ferrone, Lavinia; la Marca, Giancarlo; Serni, Sergio; Spatafora, Pietro; Catapano, Carlo V; Morandi, Andrea; Giannoni, Elisa; Chiarugi, Paola. Lactate Rewires Lipid Metabolism and Sustains a Metabolic-Epigenetic Axis in Prostate Cancer. Cancer Research. 2022;82(7):1267-1282.  PubMed