Anti PLIN2 pAb (ATL-HPA016607)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016607-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PLIN2
Alternative Gene Name: ADFP, ADRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028494: 90%, ENSRNOG00000007060: 83%
Entrez Gene ID: 123
Uniprot ID: Q99541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQ |
| Gene Sequence | ISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQ |
| Gene ID - Mouse | ENSMUSG00000028494 |
| Gene ID - Rat | ENSRNOG00000007060 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLIN2 pAb (ATL-HPA016607) | |
| Datasheet | Anti PLIN2 pAb (ATL-HPA016607) Datasheet (External Link) |
| Vendor Page | Anti PLIN2 pAb (ATL-HPA016607) at Atlas Antibodies |
| Documents & Links for Anti PLIN2 pAb (ATL-HPA016607) | |
| Datasheet | Anti PLIN2 pAb (ATL-HPA016607) Datasheet (External Link) |
| Vendor Page | Anti PLIN2 pAb (ATL-HPA016607) |
| Citations for Anti PLIN2 pAb (ATL-HPA016607) – 4 Found |
| Selen, Ebru S; Wolfgang, Michael J. mTORC1 activation is not sufficient to suppress hepatic PPARα signaling or ketogenesis. The Journal Of Biological Chemistry. 2021;297(1):100884. PubMed |
| Selmi-Ruby, Samia; Marín-Sáez, Jesús; Fildier, Aurélie; Buleté, Audrey; Abdallah, Myriam; Garcia, Jessica; Deverchère, Julie; Spinner, Loïc; Giroud, Barbara; Ibanez, Sébastien; Granjon, Thierry; Bardel, Claire; Puisieux, Alain; Fervers, Béatrice; Vulliet, Emmanuelle; Payen, Léa; Vigneron, Arnaud M. In Vivo Characterization of the Toxicological Properties of DPhP, One of the Main Degradation Products of Aryl Phosphate Esters. Environmental Health Perspectives. 2020;128(12):127006. PubMed |
| Selen, Ebru S; Choi, Joseph; Wolfgang, Michael J. Discordant hepatic fatty acid oxidation and triglyceride hydrolysis leads to liver disease. Jci Insight. 2021;6(2) PubMed |
| Ippolito, Luigi; Comito, Giuseppina; Parri, Matteo; Iozzo, Marta; Duatti, Assia; Virgilio, Francesca; Lorito, Nicla; Bacci, Marina; Pardella, Elisa; Sandrini, Giada; Bianchini, Francesca; Damiano, Roberta; Ferrone, Lavinia; la Marca, Giancarlo; Serni, Sergio; Spatafora, Pietro; Catapano, Carlo V; Morandi, Andrea; Giannoni, Elisa; Chiarugi, Paola. Lactate Rewires Lipid Metabolism and Sustains a Metabolic-Epigenetic Axis in Prostate Cancer. Cancer Research. 2022;82(7):1267-1282. PubMed |