Anti PLEKHO2 pAb (ATL-HPA040055)

Atlas Antibodies

Catalog No.: ATL-HPA040055-25

Protein Description: pleckstrin homology domain containing, family O member 2
Gene Name: PLEKHO2
Alternative Gene Name: DKFZp761K2312, PLEKHQ1, PP1628, pp9099
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050721: 57%, ENSRNOG00000029242: 59%
Entrez Gene ID: 80301
Uniprot ID: Q8TD55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVLPDKLKVSWENPSPQEAPAAESAEPSQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDD
• Gene Sequence: SVLPDKLKVSWENPSPQEAPAAESAEPSQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDD
• Gene ID - Mouse: ENSMUSG00000050721
• Gene ID - Rat: ENSRNOG00000029242
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.