Anti PLEKHN1 pAb (ATL-HPA031742)

Atlas Antibodies

Catalog No.: ATL-HPA031742-25

Protein Description: pleckstrin homology domain containing, family N member 1
Gene Name: PLEKHN1
Alternative Gene Name: DKFZP434H2010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078485: 77%, ENSRNOG00000020295: 80%
Entrez Gene ID: 84069
Uniprot ID: Q494U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQV
• Gene Sequence: IFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQV
• Gene ID - Mouse: ENSMUSG00000078485
• Gene ID - Rat: ENSRNOG00000020295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.