Anti PLEKHM3 pAb (ATL-HPA035046)

Atlas Antibodies

Catalog No.: ATL-HPA035046-100

Protein Description: pleckstrin homology domain containing, family M, member 3
Gene Name: PLEKHM3
Alternative Gene Name: DAPR, PLEKHM1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051344: 93%, ENSRNOG00000023760: 94%
Entrez Gene ID: 389072
Uniprot ID: Q6ZWE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDNLSWMEQKEASTFNFFNICQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQVD
• Gene Sequence: MIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDNLSWMEQKEASTFNFFNICQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQVD
• Gene ID - Mouse: ENSMUSG00000051344
• Gene ID - Rat: ENSRNOG00000023760
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.