Anti PLEKHM2 pAb (ATL-HPA032304)

Atlas Antibodies

Catalog No.: ATL-HPA032304-25

Protein Description: pleckstrin homology domain containing, family M (with RUN domain) member 2
Gene Name: PLEKHM2
Alternative Gene Name: KIAA0842
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028917: 95%, ENSRNOG00000012163: 96%
Entrez Gene ID: 23207
Uniprot ID: Q8IWE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTQEVLCQLKRDQPSPCLSSAEDSGVDEGQGSPSEMVHSSEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKPYLVEEAVSYNELDYVSV
• Gene Sequence: GTQEVLCQLKRDQPSPCLSSAEDSGVDEGQGSPSEMVHSSEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKPYLVEEAVSYNELDYVSV
• Gene ID - Mouse: ENSMUSG00000028917
• Gene ID - Rat: ENSRNOG00000012163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLEKHM2 pAb (ATL-HPA032304) – 2 Found

Marwaha, Rituraj; Arya, Subhash B; Jagga, Divya; Kaur, Harmeet; Tuli, Amit; Sharma, Mahak. The Rab7 effector PLEKHM1 binds Arl8b to promote cargo traffic to lysosomes. The Journal Of Cell Biology. 2017;216(4):1051-1070. 

Sindhwani, Aastha; Arya, Subhash B; Kaur, Harmeet; Jagga, Divya; Tuli, Amit; Sharma, Mahak. Salmonella exploits the host endolysosomal tethering factor HOPS complex to promote its intravacuolar replication. Plos Pathogens. 2017;13(10):e1006700.