Anti PLEKHM1 pAb (ATL-HPA039473)

Atlas Antibodies

Catalog No.: ATL-HPA039473-25

Protein Description: pleckstrin homology domain containing, family M (with RUN domain) member 1
Gene Name: PLEKHM1
Alternative Gene Name: KIAA0356
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034247: 94%, ENSRNOG00000028521: 94%
Entrez Gene ID: 9842
Uniprot ID: Q9Y4G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGR
• Gene Sequence: PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGR
• Gene ID - Mouse: ENSMUSG00000034247
• Gene ID - Rat: ENSRNOG00000028521
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.