Anti PLEKHG4B pAb (ATL-HPA036274)

Atlas Antibodies

Catalog No.: ATL-HPA036274-25

Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 4B
Gene Name: PLEKHG4B
Alternative Gene Name: KIAA1909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024797: 26%, ENSRNOG00000015425: 26%
Entrez Gene ID: 153478
Uniprot ID: Q96PX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDRVDEEVHRLVLTSNNRLQQLEHLRELASLLEGNDQQSCQKGLQLAKENPQRTEEMVQDFRRGLSAVVSQAECREGELARWTRSSELCETVS
• Gene Sequence: YDRVDEEVHRLVLTSNNRLQQLEHLRELASLLEGNDQQSCQKGLQLAKENPQRTEEMVQDFRRGLSAVVSQAECREGELARWTRSSELCETVS
• Gene ID - Mouse: ENSMUSG00000024797
• Gene ID - Rat: ENSRNOG00000015425
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.