Anti PLEKHF2 pAb (ATL-HPA024829)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024829-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PLEKHF2
Alternative Gene Name: FLJ13187, PHAFIN2, ZFYVE18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049969: 99%, ENSRNOG00000026662: 98%
Entrez Gene ID: 79666
Uniprot ID: Q9H8W4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN |
| Gene Sequence | VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN |
| Gene ID - Mouse | ENSMUSG00000049969 |
| Gene ID - Rat | ENSRNOG00000026662 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLEKHF2 pAb (ATL-HPA024829) | |
| Datasheet | Anti PLEKHF2 pAb (ATL-HPA024829) Datasheet (External Link) |
| Vendor Page | Anti PLEKHF2 pAb (ATL-HPA024829) at Atlas Antibodies |
| Documents & Links for Anti PLEKHF2 pAb (ATL-HPA024829) | |
| Datasheet | Anti PLEKHF2 pAb (ATL-HPA024829) Datasheet (External Link) |
| Vendor Page | Anti PLEKHF2 pAb (ATL-HPA024829) |
| Citations for Anti PLEKHF2 pAb (ATL-HPA024829) – 2 Found |
| Tan, Kia Wee; Nähse, Viola; Campsteijn, Coen; Brech, Andreas; Schink, Kay Oliver; Stenmark, Harald. JIP4 is recruited by the phosphoinositide-binding protein Phafin2 to promote recycling tubules on macropinosomes. Journal Of Cell Science. 2021;134(14) PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |