Anti PLEKHF2 pAb (ATL-HPA024829)

Atlas Antibodies

Catalog No.: ATL-HPA024829-25

Protein Description: pleckstrin homology domain containing, family F (with FYVE domain) member 2
Gene Name: PLEKHF2
Alternative Gene Name: FLJ13187, PHAFIN2, ZFYVE18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049969: 99%, ENSRNOG00000026662: 98%
Entrez Gene ID: 79666
Uniprot ID: Q9H8W4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN
• Gene Sequence: VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN
• Gene ID - Mouse: ENSMUSG00000049969
• Gene ID - Rat: ENSRNOG00000026662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLEKHF2 pAb (ATL-HPA024829) – 2 Found

Tan, Kia Wee; Nähse, Viola; Campsteijn, Coen; Brech, Andreas; Schink, Kay Oliver; Stenmark, Harald. JIP4 is recruited by the phosphoinositide-binding protein Phafin2 to promote recycling tubules on macropinosomes. Journal Of Cell Science. 2021;134(14) 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.