Anti PLCD4 pAb (ATL-HPA038139 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038139-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phospholipase C, delta 4
Gene Name: PLCD4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026173: 76%, ENSRNOG00000016361: 73%
Entrez Gene ID: 84812
Uniprot ID: Q9BRC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELL
Gene Sequence MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELL
Gene ID - Mouse ENSMUSG00000026173
Gene ID - Rat ENSRNOG00000016361
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLCD4 pAb (ATL-HPA038139 w/enhanced validation)
Datasheet Anti PLCD4 pAb (ATL-HPA038139 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLCD4 pAb (ATL-HPA038139 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PLCD4 pAb (ATL-HPA038139 w/enhanced validation)
Datasheet Anti PLCD4 pAb (ATL-HPA038139 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLCD4 pAb (ATL-HPA038139 w/enhanced validation)