Anti PLAC9 pAb (ATL-HPA043469)

Atlas Antibodies

Catalog No.:
ATL-HPA043469-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: placenta-specific 9
Gene Name: PLAC9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094800: 74%, ENSRNOG00000011263: 69%
Entrez Gene ID: 219348
Uniprot ID: Q5JTB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF
Gene Sequence EPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF
Gene ID - Mouse ENSMUSG00000094800
Gene ID - Rat ENSRNOG00000011263
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLAC9 pAb (ATL-HPA043469)
Datasheet Anti PLAC9 pAb (ATL-HPA043469) Datasheet (External Link)
Vendor Page Anti PLAC9 pAb (ATL-HPA043469) at Atlas Antibodies

Documents & Links for Anti PLAC9 pAb (ATL-HPA043469)
Datasheet Anti PLAC9 pAb (ATL-HPA043469) Datasheet (External Link)
Vendor Page Anti PLAC9 pAb (ATL-HPA043469)