Anti PLAC8 pAb (ATL-HPA040465)

Atlas Antibodies

Catalog No.: ATL-HPA040465-100

Protein Description: placenta-specific 8
Gene Name: PLAC8
Alternative Gene Name: C15, onzin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029322: 82%, ENSRNOG00000002217: 82%
Entrez Gene ID: 51316
Uniprot ID: Q9NZF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
• Gene Sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
• Gene ID - Mouse: ENSMUSG00000029322
• Gene ID - Rat: ENSRNOG00000002217
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLAC8 pAb (ATL-HPA040465) – 2 Found

Blue, Emily K; Sheehan, BreAnn M; Nuss, Zia V; Boyle, Frances A; Hocutt, Caleb M; Gohn, Cassandra R; Varberg, Kaela M; McClintick, Jeanette N; Haneline, Laura S. Epigenetic Regulation of Placenta-Specific 8 Contributes to Altered Function of Endothelial Colony-Forming Cells Exposed to Intrauterine Gestational Diabetes Mellitus. Diabetes. 2015;64(7):2664-75. 

Strack, Elisabeth; Rolfe, P Alexander; Fink, Annika F; Bankov, Katrin; Schmid, Tobias; Solbach, Christine; Savai, Rajkumar; Sha, Weixiao; Pradel, Leon; Hartmann, Sylvia; Brüne, Bernhard; Weigert, Andreas. Identification of tumor-associated macrophage subsets that are associated with breast cancer prognosis. Clinical And Translational Medicine. 2020;10(8):e239.