Anti PLA2G4C pAb (ATL-HPA043083)

Atlas Antibodies

Catalog No.: ATL-HPA043083-25

Protein Description: phospholipase A2, group IVC (cytosolic, calcium-independent)
Gene Name: PLA2G4C
Alternative Gene Name: cPLA2-gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033847: 56%, ENSRNOG00000026764: 53%
Entrez Gene ID: 8605
Uniprot ID: Q9UP65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD
• Gene Sequence: EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD
• Gene ID - Mouse: ENSMUSG00000033847
• Gene ID - Rat: ENSRNOG00000026764
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLA2G4C pAb (ATL-HPA043083) – 2 Found

Xu, Song; Pei, Rongjuan; Guo, Min; Han, Qingxia; Lai, Juan; Wang, Yun; Wu, Chunchen; Zhou, Yuan; Lu, Mengji; Chen, Xinwen. Cytosolic phospholipase A2 gamma is involved in hepatitis C virus replication and assembly. Journal Of Virology. 2012;86(23):13025-37. 

Pniewska-Dawidczyk, Ewa; Kupryś-Lipińska, Izabela; Turek, Gabriela; Kacprzak, Dorota; Wieczfinska, Joanna; Kleniewska, Paulina; Kuna, Piotr; Pawliczak, Rafal. Expression of cPLA(2)γ mRNA and protein differs the response of PBMC from severe and non-severe asthmatics to bacterial lipopolysaccharide and house dust mite allergen. International Journal Of Immunopathology And Pharmacology. 2021;35( 33626953):2058738421990952.