Anti PKDCC pAb (ATL-HPA026526)

Atlas Antibodies

Catalog No.: ATL-HPA026526-25

Protein Description: protein kinase domain containing, cytoplasmic
Gene Name: PKDCC
Alternative Gene Name: SgK493, Vlk
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024247: 97%, ENSRNOG00000004205: 99%
Entrez Gene ID: 91461
Uniprot ID: Q504Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD
• Gene Sequence: QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD
• Gene ID - Mouse: ENSMUSG00000024247
• Gene ID - Rat: ENSRNOG00000004205
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.