Anti PKD2L2 pAb (ATL-HPA043634)

Atlas Antibodies

Catalog No.:
ATL-HPA043634-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: polycystic kidney disease 2-like 2
Gene Name: PKD2L2
Alternative Gene Name: TRPP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014503: 70%, ENSRNOG00000025489: 64%
Entrez Gene ID: 27039
Uniprot ID: Q9NZM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITR
Gene Sequence NNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITR
Gene ID - Mouse ENSMUSG00000014503
Gene ID - Rat ENSRNOG00000025489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PKD2L2 pAb (ATL-HPA043634)
Datasheet Anti PKD2L2 pAb (ATL-HPA043634) Datasheet (External Link)
Vendor Page Anti PKD2L2 pAb (ATL-HPA043634) at Atlas Antibodies

Documents & Links for Anti PKD2L2 pAb (ATL-HPA043634)
Datasheet Anti PKD2L2 pAb (ATL-HPA043634) Datasheet (External Link)
Vendor Page Anti PKD2L2 pAb (ATL-HPA043634)