Anti PIWIL4 pAb (ATL-HPA036588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036588-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PIWIL4
Alternative Gene Name: FLJ36156, HIWI2, Miwi2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036912: 74%, ENSRNOG00000009043: 73%
Entrez Gene ID: 143689
Uniprot ID: Q7Z3Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCILPSNQKTYYDSI |
| Gene Sequence | AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCILPSNQKTYYDSI |
| Gene ID - Mouse | ENSMUSG00000036912 |
| Gene ID - Rat | ENSRNOG00000009043 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIWIL4 pAb (ATL-HPA036588) | |
| Datasheet | Anti PIWIL4 pAb (ATL-HPA036588) Datasheet (External Link) |
| Vendor Page | Anti PIWIL4 pAb (ATL-HPA036588) at Atlas Antibodies |
| Documents & Links for Anti PIWIL4 pAb (ATL-HPA036588) | |
| Datasheet | Anti PIWIL4 pAb (ATL-HPA036588) Datasheet (External Link) |
| Vendor Page | Anti PIWIL4 pAb (ATL-HPA036588) |