Anti PISD pAb (ATL-HPA031091)

Atlas Antibodies

Catalog No.: ATL-HPA031091-25

Protein Description: phosphatidylserine decarboxylase
Gene Name: PISD
Alternative Gene Name: dJ858B16.2, PSDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093574: 93%, ENSRNOG00000018319: 94%
Entrez Gene ID: 23761
Uniprot ID: Q9UG56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSISPSD
• Gene Sequence: YKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSISPSD
• Gene ID - Mouse: ENSMUSG00000093574
• Gene ID - Rat: ENSRNOG00000018319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PISD pAb (ATL-HPA031091) – 2 Found

Tambini, Marc D; Pera, Marta; Kanter, Ellen; Yang, Hua; Guardia-Laguarta, Cristina; Holtzman, David; Sulzer, David; Area-Gomez, Estela; Schon, Eric A. ApoE4 upregulates the activity of mitochondria-associated ER membranes. Embo Reports. 2016;17(1):27-36. 

Johnson, Jordan M; Peterlin, Alek D; Balderas, Enrique; Sustarsic, Elahu G; Maschek, J Alan; Lang, Marisa J; Jara-Ramos, Alejandro; Panic, Vanja; Morgan, Jeffrey T; Villanueva, Claudio J; Sanchez, Alejandro; Rutter, Jared; Lodhi, Irfan J; Cox, James E; Fisher-Wellman, Kelsey H; Chaudhuri, Dipayan; Gerhart-Hines, Zachary; Funai, Katsuhiko. Mitochondrial phosphatidylethanolamine modulates UCP1 to promote brown adipose thermogenesis. Science Advances. 2023;9(8):eade7864.