Anti PIP4K2C pAb (ATL-HPA028658)

Atlas Antibodies

Catalog No.: ATL-HPA028658-25

Protein Description: phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
Gene Name: PIP4K2C
Alternative Gene Name: FLJ22055, PIP5K2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025417: 95%, ENSRNOG00000005138: 96%
Entrez Gene ID: 79837
Uniprot ID: Q8TBX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLI
• Gene Sequence: LEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLI
• Gene ID - Mouse: ENSMUSG00000025417
• Gene ID - Rat: ENSRNOG00000005138
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PIP4K2C pAb (ATL-HPA028658) – 1 Found

Shim, Hyeseok; Wu, Chuan; Ramsamooj, Shivan; Bosch, Kaitlyn N; Chen, Zuojia; Emerling, Brooke M; Yun, Jihye; Liu, Hui; Choo-Wing, Rayman; Yang, Zhiwei; Wulf, Gerburg M; Kuchroo, Vijay Kumar; Cantley, Lewis C. Deletion of the gene Pip4k2c, a novel phosphatidylinositol kinase, results in hyperactivation of the immune system. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(27):7596-601.