Anti PIK3R4 pAb (ATL-HPA036032)

Atlas Antibodies

Catalog No.: ATL-HPA036032-25

Protein Description: phosphoinositide-3-kinase, regulatory subunit 4
Gene Name: PIK3R4
Alternative Gene Name: p150, VPS15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032571: 100%, ENSRNOG00000013669: 100%
Entrez Gene ID: 30849
Uniprot ID: Q99570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTL
• Gene Sequence: GGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTL
• Gene ID - Mouse: ENSMUSG00000032571
• Gene ID - Rat: ENSRNOG00000013669
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.