Anti PIK3C2A pAb (ATL-HPA037641)

Atlas Antibodies

Catalog No.:
ATL-HPA037641-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha
Gene Name: PIK3C2A
Alternative Gene Name: PI3K-C2alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030660: 86%, ENSRNOG00000020479: 88%
Entrez Gene ID: 5286
Uniprot ID: O00443
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSE
Gene Sequence PRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSE
Gene ID - Mouse ENSMUSG00000030660
Gene ID - Rat ENSRNOG00000020479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIK3C2A pAb (ATL-HPA037641)
Datasheet Anti PIK3C2A pAb (ATL-HPA037641) Datasheet (External Link)
Vendor Page Anti PIK3C2A pAb (ATL-HPA037641) at Atlas Antibodies

Documents & Links for Anti PIK3C2A pAb (ATL-HPA037641)
Datasheet Anti PIK3C2A pAb (ATL-HPA037641) Datasheet (External Link)
Vendor Page Anti PIK3C2A pAb (ATL-HPA037641)