Anti PIGP pAb (ATL-HPA026921 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026921-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PIGP
Alternative Gene Name: DCRC, DSCR5, DSRC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022940: 84%, ENSRNOG00000039850: 86%
Entrez Gene ID: 51227
Uniprot ID: P57054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK |
| Gene Sequence | NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK |
| Gene ID - Mouse | ENSMUSG00000022940 |
| Gene ID - Rat | ENSRNOG00000039850 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) | |
| Datasheet | Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) | |
| Datasheet | Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) |
| Citations for Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) – 1 Found |
| Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458. PubMed |