Anti PIGP pAb (ATL-HPA026921 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026921-25

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class P
Gene Name: PIGP
Alternative Gene Name: DCRC, DSCR5, DSRC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022940: 84%, ENSRNOG00000039850: 86%
Entrez Gene ID: 51227
Uniprot ID: P57054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK
• Gene Sequence: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK
• Gene ID - Mouse: ENSMUSG00000022940
• Gene ID - Rat: ENSRNOG00000039850
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PIGP pAb (ATL-HPA026921 w/enhanced validation) – 1 Found

Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458.