Anti PIGB pAb (ATL-HPA039929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039929-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PIGB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079469: 84%, ENSRNOG00000059622: 84%
Entrez Gene ID: 9488
Uniprot ID: Q92521
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD |
| Gene Sequence | QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD |
| Gene ID - Mouse | ENSMUSG00000079469 |
| Gene ID - Rat | ENSRNOG00000059622 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIGB pAb (ATL-HPA039929) | |
| Datasheet | Anti PIGB pAb (ATL-HPA039929) Datasheet (External Link) |
| Vendor Page | Anti PIGB pAb (ATL-HPA039929) at Atlas Antibodies |
| Documents & Links for Anti PIGB pAb (ATL-HPA039929) | |
| Datasheet | Anti PIGB pAb (ATL-HPA039929) Datasheet (External Link) |
| Vendor Page | Anti PIGB pAb (ATL-HPA039929) |