Anti PIGB pAb (ATL-HPA039929)

Atlas Antibodies

Catalog No.: ATL-HPA039929-25

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class B
Gene Name: PIGB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079469: 84%, ENSRNOG00000059622: 84%
Entrez Gene ID: 9488
Uniprot ID: Q92521
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD
• Gene Sequence: QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD
• Gene ID - Mouse: ENSMUSG00000079469
• Gene ID - Rat: ENSRNOG00000059622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.