Anti PIEZO2 pAb (ATL-HPA031975)

Atlas Antibodies

Catalog No.:
ATL-HPA031975-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: piezo-type mechanosensitive ion channel component 2
Gene Name: PIEZO2
Alternative Gene Name: C18orf30, C18orf58, FAM38B, FAM38B2, FLJ23144, FLJ23403, FLJ34907, HsT748, HsT771
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041482: 98%, ENSRNOG00000038784: 100%
Entrez Gene ID: 63895
Uniprot ID: Q9H5I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLS
Gene Sequence QFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLS
Gene ID - Mouse ENSMUSG00000041482
Gene ID - Rat ENSRNOG00000038784
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIEZO2 pAb (ATL-HPA031975)
Datasheet Anti PIEZO2 pAb (ATL-HPA031975) Datasheet (External Link)
Vendor Page Anti PIEZO2 pAb (ATL-HPA031975) at Atlas Antibodies

Documents & Links for Anti PIEZO2 pAb (ATL-HPA031975)
Datasheet Anti PIEZO2 pAb (ATL-HPA031975) Datasheet (External Link)
Vendor Page Anti PIEZO2 pAb (ATL-HPA031975)
Citations for Anti PIEZO2 pAb (ATL-HPA031975) – 1 Found
Allen, Ariana; Maddala, Rupalatha; Eldawy, Camelia; Rao, Ponugoti Vasantha. Mechanical Load and Piezo1 Channel Regulated Myosin II Activity in Mouse Lenses. International Journal Of Molecular Sciences. 2022;23(9)  PubMed