Anti PIEZO2 pAb (ATL-HPA015986)

Atlas Antibodies

Catalog No.: ATL-HPA015986-25

Protein Description: piezo-type mechanosensitive ion channel component 2
Gene Name: PIEZO2
Alternative Gene Name: C18orf30, C18orf58, FAM38B, FAM38B2, FLJ23144, FLJ23403, FLJ34907, HsT748, HsT771
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041482: 76%, ENSRNOG00000038784: 77%
Entrez Gene ID: 63895
Uniprot ID: Q9H5I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESEKPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKM
• Gene Sequence: ESEKPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKM
• Gene ID - Mouse: ENSMUSG00000041482
• Gene ID - Rat: ENSRNOG00000038784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PIEZO2 pAb (ATL-HPA015986) – 1 Found

Lou, Weiyang; Liu, Jingxing; Ding, Bisha; Jin, Luqi; Xu, Liang; Li, Xia; Chen, Jing; Fan, Weimin. Five miRNAs-mediated PIEZO2 downregulation, accompanied with activation of Hedgehog signaling pathway, predicts poor prognosis of breast cancer. Aging. 2019;11(9):2628-2652.