Anti PI16 pAb (ATL-HPA043763)

Atlas Antibodies

Catalog No.: ATL-HPA043763-25

Protein Description: peptidase inhibitor 16
Gene Name: PI16
Alternative Gene Name: dJ90K10.5, MGC45378, MSMBBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024011: 61%, ENSRNOG00000000525: 53%
Entrez Gene ID: 221476
Uniprot ID: Q6UXB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVT
• Gene Sequence: CEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVT
• Gene ID - Mouse: ENSMUSG00000024011
• Gene ID - Rat: ENSRNOG00000000525
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PI16 pAb (ATL-HPA043763) – 2 Found

Hazell, Georgina G J; Peachey, Alasdair M G; Teasdale, Jack E; Sala-Newby, Graciela B; Angelini, Gianni D; Newby, Andrew C; White, Stephen J. PI16 is a shear stress and inflammation-regulated inhibitor of MMP2. Scientific Reports. 2016;6( 27996045):39553. 

Deng, Mengqing; Yang, Shuo; Ji, Yue; Lu, Yan; Qiu, Ming; Sheng, Yanhui; Sun, Wei; Kong, Xiangqing. Overexpression of peptidase inhibitor 16 attenuates angiotensin II-induced cardiac fibrosis via regulating HDAC1 of cardiac fibroblasts. Journal Of Cellular And Molecular Medicine. 2020;24(9):5249-5259.