Anti PHYHIPL pAb (ATL-HPA038746)

Atlas Antibodies

Catalog No.:
ATL-HPA038746-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phytanoyl-CoA 2-hydroxylase interacting protein-like
Gene Name: PHYHIPL
Alternative Gene Name: Em:AC025038.1, KIAA1796
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037747: 95%, ENSRNOG00000000274: 95%
Entrez Gene ID: 84457
Uniprot ID: Q96FC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNI
Gene Sequence MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNI
Gene ID - Mouse ENSMUSG00000037747
Gene ID - Rat ENSRNOG00000000274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHYHIPL pAb (ATL-HPA038746)
Datasheet Anti PHYHIPL pAb (ATL-HPA038746) Datasheet (External Link)
Vendor Page Anti PHYHIPL pAb (ATL-HPA038746) at Atlas Antibodies

Documents & Links for Anti PHYHIPL pAb (ATL-HPA038746)
Datasheet Anti PHYHIPL pAb (ATL-HPA038746) Datasheet (External Link)
Vendor Page Anti PHYHIPL pAb (ATL-HPA038746)
Citations for Anti PHYHIPL pAb (ATL-HPA038746) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed