Anti PHLDB2 pAb (ATL-HPA035147 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035147-25

Protein Description: pleckstrin homology-like domain, family B, member 2
Gene Name: PHLDB2
Alternative Gene Name: FLJ21791, LL5b, LL5beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033149: 91%, ENSRNOG00000002171: 89%
Entrez Gene ID: 90102
Uniprot ID: Q86SQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPNTLKEGYISVNEINEPCGNSTNLSPSTQFPADADAVATEPATAVLASQPQSKEHFRSLEERKKQHKEGLYLSDTLPRKKTTSSISPHFSSATM
• Gene Sequence: NPNTLKEGYISVNEINEPCGNSTNLSPSTQFPADADAVATEPATAVLASQPQSKEHFRSLEERKKQHKEGLYLSDTLPRKKTTSSISPHFSSATM
• Gene ID - Mouse: ENSMUSG00000033149
• Gene ID - Rat: ENSRNOG00000002171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PHLDB2 pAb (ATL-HPA035147 w/enhanced validation) – 1 Found

Song, Lei; Luo, Jingjing; Wang, Hongou; Huang, Dan; Tan, Yunhao; Liu, Yao; Wang, Yingwu; Yu, Kaiwen; Zhang, Yong; Liu, Xiaoyun; Li, Dan; Luo, Zhao-Qing. Legionella pneumophila regulates host cell motility by targeting Phldb2 with a 14-3-3ζ-dependent protease effector. Elife. 2022;11( 35175192)